Anti NCAN pAb (ATL-HPA036814 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036814-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NCAN
Alternative Gene Name: CSPG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002341: 81%, ENSRNOG00000048036: 80%
Entrez Gene ID: 1463
Uniprot ID: O14594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGR |
| Gene Sequence | TDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGR |
| Gene ID - Mouse | ENSMUSG00000002341 |
| Gene ID - Rat | ENSRNOG00000048036 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NCAN pAb (ATL-HPA036814 w/enhanced validation) | |
| Datasheet | Anti NCAN pAb (ATL-HPA036814 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NCAN pAb (ATL-HPA036814 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NCAN pAb (ATL-HPA036814 w/enhanced validation) | |
| Datasheet | Anti NCAN pAb (ATL-HPA036814 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NCAN pAb (ATL-HPA036814 w/enhanced validation) |
| Citations for Anti NCAN pAb (ATL-HPA036814 w/enhanced validation) – 1 Found |
| Junaković, Alisa; Kopić, Janja; Duque, Alvaro; Rakic, Pasko; Krsnik, Željka; Kostović, Ivica. Laminar dynamics of deep projection neurons and mode of subplate formation are hallmarks of histogenetic subdivisions of the human cingulate cortex before onset of arealization. Brain Structure & Function. 2023;228(2):613-633. PubMed |