Anti NBEAL1 pAb (ATL-HPA049189)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049189-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NBEAL1
Alternative Gene Name: ALS2CR16, ALS2CR17, MGC164581
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073664: 91%, ENSRNOG00000021525: 91%
Entrez Gene ID: 65065
Uniprot ID: Q6ZS30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE |
| Gene Sequence | QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE |
| Gene ID - Mouse | ENSMUSG00000073664 |
| Gene ID - Rat | ENSRNOG00000021525 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NBEAL1 pAb (ATL-HPA049189) | |
| Datasheet | Anti NBEAL1 pAb (ATL-HPA049189) Datasheet (External Link) |
| Vendor Page | Anti NBEAL1 pAb (ATL-HPA049189) at Atlas Antibodies |
| Documents & Links for Anti NBEAL1 pAb (ATL-HPA049189) | |
| Datasheet | Anti NBEAL1 pAb (ATL-HPA049189) Datasheet (External Link) |
| Vendor Page | Anti NBEAL1 pAb (ATL-HPA049189) |