Anti NBEAL1 pAb (ATL-HPA049189)

Atlas Antibodies

Catalog No.: ATL-HPA049189-25

Protein Description: neurobeachin-like 1
Gene Name: NBEAL1
Alternative Gene Name: ALS2CR16, ALS2CR17, MGC164581
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073664: 91%, ENSRNOG00000021525: 91%
Entrez Gene ID: 65065
Uniprot ID: Q6ZS30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE
• Gene Sequence: QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE
• Gene ID - Mouse: ENSMUSG00000073664
• Gene ID - Rat: ENSRNOG00000021525
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.