Anti NAV3 pAb (ATL-HPA061392)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061392-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NAV3
Alternative Gene Name: KIAA0938, POMFIL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020181: 95%, ENSRNOG00000052157: 97%
Entrez Gene ID: 89795
Uniprot ID: Q8IVL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSD |
| Gene Sequence | SPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSD |
| Gene ID - Mouse | ENSMUSG00000020181 |
| Gene ID - Rat | ENSRNOG00000052157 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NAV3 pAb (ATL-HPA061392) | |
| Datasheet | Anti NAV3 pAb (ATL-HPA061392) Datasheet (External Link) |
| Vendor Page | Anti NAV3 pAb (ATL-HPA061392) at Atlas Antibodies |
| Documents & Links for Anti NAV3 pAb (ATL-HPA061392) | |
| Datasheet | Anti NAV3 pAb (ATL-HPA061392) Datasheet (External Link) |
| Vendor Page | Anti NAV3 pAb (ATL-HPA061392) |