Anti NAV3 pAb (ATL-HPA061392)

Atlas Antibodies

Catalog No.:
ATL-HPA061392-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: neuron navigator 3
Gene Name: NAV3
Alternative Gene Name: KIAA0938, POMFIL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020181: 95%, ENSRNOG00000052157: 97%
Entrez Gene ID: 89795
Uniprot ID: Q8IVL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSD
Gene Sequence SPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSD
Gene ID - Mouse ENSMUSG00000020181
Gene ID - Rat ENSRNOG00000052157
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAV3 pAb (ATL-HPA061392)
Datasheet Anti NAV3 pAb (ATL-HPA061392) Datasheet (External Link)
Vendor Page Anti NAV3 pAb (ATL-HPA061392) at Atlas Antibodies

Documents & Links for Anti NAV3 pAb (ATL-HPA061392)
Datasheet Anti NAV3 pAb (ATL-HPA061392) Datasheet (External Link)
Vendor Page Anti NAV3 pAb (ATL-HPA061392)