Anti NAV3 pAb (ATL-HPA061392)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061392-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NAV3
Alternative Gene Name: KIAA0938, POMFIL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020181: 95%, ENSRNOG00000052157: 97%
Entrez Gene ID: 89795
Uniprot ID: Q8IVL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSD |
Gene Sequence | SPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSD |
Gene ID - Mouse | ENSMUSG00000020181 |
Gene ID - Rat | ENSRNOG00000052157 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NAV3 pAb (ATL-HPA061392) | |
Datasheet | Anti NAV3 pAb (ATL-HPA061392) Datasheet (External Link) |
Vendor Page | Anti NAV3 pAb (ATL-HPA061392) at Atlas Antibodies |
Documents & Links for Anti NAV3 pAb (ATL-HPA061392) | |
Datasheet | Anti NAV3 pAb (ATL-HPA061392) Datasheet (External Link) |
Vendor Page | Anti NAV3 pAb (ATL-HPA061392) |