Anti NAT9 pAb (ATL-HPA057149)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057149-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NAT9
Alternative Gene Name: DKFZP564C103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015542: 70%, ENSRNOG00000003264: 73%
Entrez Gene ID: 26151
Uniprot ID: Q9BTE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEP |
| Gene Sequence | TLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEP |
| Gene ID - Mouse | ENSMUSG00000015542 |
| Gene ID - Rat | ENSRNOG00000003264 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NAT9 pAb (ATL-HPA057149) | |
| Datasheet | Anti NAT9 pAb (ATL-HPA057149) Datasheet (External Link) |
| Vendor Page | Anti NAT9 pAb (ATL-HPA057149) at Atlas Antibodies |
| Documents & Links for Anti NAT9 pAb (ATL-HPA057149) | |
| Datasheet | Anti NAT9 pAb (ATL-HPA057149) Datasheet (External Link) |
| Vendor Page | Anti NAT9 pAb (ATL-HPA057149) |