Anti NAT9 pAb (ATL-HPA057149)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057149-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NAT9
Alternative Gene Name: DKFZP564C103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015542: 70%, ENSRNOG00000003264: 73%
Entrez Gene ID: 26151
Uniprot ID: Q9BTE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEP |
Gene Sequence | TLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEP |
Gene ID - Mouse | ENSMUSG00000015542 |
Gene ID - Rat | ENSRNOG00000003264 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NAT9 pAb (ATL-HPA057149) | |
Datasheet | Anti NAT9 pAb (ATL-HPA057149) Datasheet (External Link) |
Vendor Page | Anti NAT9 pAb (ATL-HPA057149) at Atlas Antibodies |
Documents & Links for Anti NAT9 pAb (ATL-HPA057149) | |
Datasheet | Anti NAT9 pAb (ATL-HPA057149) Datasheet (External Link) |
Vendor Page | Anti NAT9 pAb (ATL-HPA057149) |