Anti NAT8 pAb (ATL-HPA074519)

Atlas Antibodies

Catalog No.: ATL-HPA074519-25

Protein Description: N-acetyltransferase 8 (GCN5-related, putative)
Gene Name: NAT8
Alternative Gene Name: ATase2, GLA, Hcml1, TSC501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033634: 73%, ENSRNOG00000057086: 69%
Entrez Gene ID: 9027
Uniprot ID: Q9UHE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCV
• Gene Sequence: DSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCV
• Gene ID - Mouse: ENSMUSG00000033634
• Gene ID - Rat: ENSRNOG00000057086
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.