Anti NAT8 pAb (ATL-HPA074519)

Atlas Antibodies

Catalog No.:
ATL-HPA074519-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: N-acetyltransferase 8 (GCN5-related, putative)
Gene Name: NAT8
Alternative Gene Name: ATase2, GLA, Hcml1, TSC501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033634: 73%, ENSRNOG00000057086: 69%
Entrez Gene ID: 9027
Uniprot ID: Q9UHE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCV
Gene Sequence DSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCV
Gene ID - Mouse ENSMUSG00000033634
Gene ID - Rat ENSRNOG00000057086
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAT8 pAb (ATL-HPA074519)
Datasheet Anti NAT8 pAb (ATL-HPA074519) Datasheet (External Link)
Vendor Page Anti NAT8 pAb (ATL-HPA074519) at Atlas Antibodies

Documents & Links for Anti NAT8 pAb (ATL-HPA074519)
Datasheet Anti NAT8 pAb (ATL-HPA074519) Datasheet (External Link)
Vendor Page Anti NAT8 pAb (ATL-HPA074519)