Anti NAT10 pAb (ATL-HPA071628)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071628-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NAT10
Alternative Gene Name: FLJ10774, FLJ12179, hALP, KIAA1709, NET43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027185: 99%, ENSRNOG00000008663: 99%
Entrez Gene ID: 55226
Uniprot ID: Q9H0A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAP |
Gene Sequence | RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAP |
Gene ID - Mouse | ENSMUSG00000027185 |
Gene ID - Rat | ENSRNOG00000008663 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NAT10 pAb (ATL-HPA071628) | |
Datasheet | Anti NAT10 pAb (ATL-HPA071628) Datasheet (External Link) |
Vendor Page | Anti NAT10 pAb (ATL-HPA071628) at Atlas Antibodies |
Documents & Links for Anti NAT10 pAb (ATL-HPA071628) | |
Datasheet | Anti NAT10 pAb (ATL-HPA071628) Datasheet (External Link) |
Vendor Page | Anti NAT10 pAb (ATL-HPA071628) |