Anti NAPEPLD pAb (ATL-HPA019832)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019832-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NAPEPLD
Alternative Gene Name: C7orf18, FMP30, NAPE-PLD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044968: 85%, ENSRNOG00000011363: 85%
Entrez Gene ID: 222236
Uniprot ID: Q6IQ20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE |
| Gene Sequence | MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE |
| Gene ID - Mouse | ENSMUSG00000044968 |
| Gene ID - Rat | ENSRNOG00000011363 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NAPEPLD pAb (ATL-HPA019832) | |
| Datasheet | Anti NAPEPLD pAb (ATL-HPA019832) Datasheet (External Link) |
| Vendor Page | Anti NAPEPLD pAb (ATL-HPA019832) at Atlas Antibodies |
| Documents & Links for Anti NAPEPLD pAb (ATL-HPA019832) | |
| Datasheet | Anti NAPEPLD pAb (ATL-HPA019832) Datasheet (External Link) |
| Vendor Page | Anti NAPEPLD pAb (ATL-HPA019832) |