Anti NAPEPLD pAb (ATL-HPA019832)

Atlas Antibodies

Catalog No.: ATL-HPA019832-25

Protein Description: N-acyl phosphatidylethanolamine phospholipase D
Gene Name: NAPEPLD
Alternative Gene Name: C7orf18, FMP30, NAPE-PLD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044968: 85%, ENSRNOG00000011363: 85%
Entrez Gene ID: 222236
Uniprot ID: Q6IQ20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE
• Gene Sequence: MKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDE
• Gene ID - Mouse: ENSMUSG00000044968
• Gene ID - Rat: ENSRNOG00000011363
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.