Anti NAP1L5 pAb (ATL-HPA058227)

Atlas Antibodies

Catalog No.:
ATL-HPA058227-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nucleosome assembly protein 1-like 5
Gene Name: NAP1L5
Alternative Gene Name: DRLM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055430: 71%, ENSRNOG00000007808: 71%
Entrez Gene ID: 266812
Uniprot ID: Q96NT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCR
Gene Sequence AAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCR
Gene ID - Mouse ENSMUSG00000055430
Gene ID - Rat ENSRNOG00000007808
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAP1L5 pAb (ATL-HPA058227)
Datasheet Anti NAP1L5 pAb (ATL-HPA058227) Datasheet (External Link)
Vendor Page Anti NAP1L5 pAb (ATL-HPA058227) at Atlas Antibodies

Documents & Links for Anti NAP1L5 pAb (ATL-HPA058227)
Datasheet Anti NAP1L5 pAb (ATL-HPA058227) Datasheet (External Link)
Vendor Page Anti NAP1L5 pAb (ATL-HPA058227)