Anti NAP1L2 pAb (ATL-HPA057065)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057065-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: NAP1L2
Alternative Gene Name: BPX, MGC26243
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000082229: 93%, ENSRNOG00000029087: 53%
Entrez Gene ID: 4674
Uniprot ID: Q9ULW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NELLTKTYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTL |
| Gene Sequence | NELLTKTYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTL |
| Gene ID - Mouse | ENSMUSG00000082229 |
| Gene ID - Rat | ENSRNOG00000029087 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NAP1L2 pAb (ATL-HPA057065) | |
| Datasheet | Anti NAP1L2 pAb (ATL-HPA057065) Datasheet (External Link) |
| Vendor Page | Anti NAP1L2 pAb (ATL-HPA057065) at Atlas Antibodies |
| Documents & Links for Anti NAP1L2 pAb (ATL-HPA057065) | |
| Datasheet | Anti NAP1L2 pAb (ATL-HPA057065) Datasheet (External Link) |
| Vendor Page | Anti NAP1L2 pAb (ATL-HPA057065) |