Anti NAP1L2 pAb (ATL-HPA057065)

Atlas Antibodies

Catalog No.: ATL-HPA057065-100

Protein Description: nucleosome assembly protein 1-like 2
Gene Name: NAP1L2
Alternative Gene Name: BPX, MGC26243
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000082229: 93%, ENSRNOG00000029087: 53%
Entrez Gene ID: 4674
Uniprot ID: Q9ULW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NELLTKTYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTL
• Gene Sequence: NELLTKTYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTL
• Gene ID - Mouse: ENSMUSG00000082229
• Gene ID - Rat: ENSRNOG00000029087
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.