Anti NAP1L2 pAb (ATL-HPA054050)

Atlas Antibodies

Catalog No.:
ATL-HPA054050-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: nucleosome assembly protein 1-like 2
Gene Name: NAP1L2
Alternative Gene Name: BPX, MGC26243
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000082229: 93%, ENSRNOG00000004457: 33%
Entrez Gene ID: 4674
Uniprot ID: Q9ULW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSPHGITSNGRDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDAIYDKIIYDNWMAAIEEVKACCKNLEALVEDID
Gene Sequence FSPHGITSNGRDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGVVREVNDAIYDKIIYDNWMAAIEEVKACCKNLEALVEDID
Gene ID - Mouse ENSMUSG00000082229
Gene ID - Rat ENSRNOG00000004457
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAP1L2 pAb (ATL-HPA054050)
Datasheet Anti NAP1L2 pAb (ATL-HPA054050) Datasheet (External Link)
Vendor Page Anti NAP1L2 pAb (ATL-HPA054050) at Atlas Antibodies

Documents & Links for Anti NAP1L2 pAb (ATL-HPA054050)
Datasheet Anti NAP1L2 pAb (ATL-HPA054050) Datasheet (External Link)
Vendor Page Anti NAP1L2 pAb (ATL-HPA054050)