Anti NANS pAb (ATL-HPA019223)

Atlas Antibodies

Catalog No.: ATL-HPA019223-25

Protein Description: N-acetylneuraminic acid synthase
Gene Name: NANS
Alternative Gene Name: SAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028334: 86%, ENSRNOG00000008945: 88%
Entrez Gene ID: 54187
Uniprot ID: Q9NR45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHG
• Gene Sequence: LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHG
• Gene ID - Mouse: ENSMUSG00000028334
• Gene ID - Rat: ENSRNOG00000008945
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.