Anti NANP pAb (ATL-HPA050342 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050342-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NANP
Alternative Gene Name: C20orf147, dJ694B14.3, HDHD4, MGC26833
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043346: 93%, ENSRNOG00000008307: 95%
Entrez Gene ID: 140838
Uniprot ID: Q8TBE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGD |
Gene Sequence | NRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGD |
Gene ID - Mouse | ENSMUSG00000043346 |
Gene ID - Rat | ENSRNOG00000008307 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NANP pAb (ATL-HPA050342 w/enhanced validation) | |
Datasheet | Anti NANP pAb (ATL-HPA050342 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NANP pAb (ATL-HPA050342 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti NANP pAb (ATL-HPA050342 w/enhanced validation) | |
Datasheet | Anti NANP pAb (ATL-HPA050342 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NANP pAb (ATL-HPA050342 w/enhanced validation) |