Anti NANOS3 pAb (ATL-HPA062989)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062989-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NANOS3
Alternative Gene Name: NANOS1L, NOS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056155: 46%, ENSRNOG00000031593: 46%
Entrez Gene ID:
Uniprot ID: P60323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG |
| Gene Sequence | LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG |
| Gene ID - Mouse | ENSMUSG00000056155 |
| Gene ID - Rat | ENSRNOG00000031593 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NANOS3 pAb (ATL-HPA062989) | |
| Datasheet | Anti NANOS3 pAb (ATL-HPA062989) Datasheet (External Link) |
| Vendor Page | Anti NANOS3 pAb (ATL-HPA062989) at Atlas Antibodies |
| Documents & Links for Anti NANOS3 pAb (ATL-HPA062989) | |
| Datasheet | Anti NANOS3 pAb (ATL-HPA062989) Datasheet (External Link) |
| Vendor Page | Anti NANOS3 pAb (ATL-HPA062989) |