Anti NANOGNB pAb (ATL-HPA060371)

Atlas Antibodies

Catalog No.:
ATL-HPA060371-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NANOG neighbor homeobox
Gene Name: NANOGNB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040327: 30%, ENSRNOG00000007850: 31%
Entrez Gene ID: 360030
Uniprot ID: Q7Z5D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TILANKKQSAMPWDQDPEQSTGNYSEDEQNGKQKWREEGEAGRKRE
Gene Sequence TILANKKQSAMPWDQDPEQSTGNYSEDEQNGKQKWREEGEAGRKRE
Gene ID - Mouse ENSMUSG00000040327
Gene ID - Rat ENSRNOG00000007850
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NANOGNB pAb (ATL-HPA060371)
Datasheet Anti NANOGNB pAb (ATL-HPA060371) Datasheet (External Link)
Vendor Page Anti NANOGNB pAb (ATL-HPA060371) at Atlas Antibodies

Documents & Links for Anti NANOGNB pAb (ATL-HPA060371)
Datasheet Anti NANOGNB pAb (ATL-HPA060371) Datasheet (External Link)
Vendor Page Anti NANOGNB pAb (ATL-HPA060371)