Anti NANOGNB pAb (ATL-HPA060371)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060371-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NANOGNB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040327: 30%, ENSRNOG00000007850: 31%
Entrez Gene ID: 360030
Uniprot ID: Q7Z5D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TILANKKQSAMPWDQDPEQSTGNYSEDEQNGKQKWREEGEAGRKRE |
| Gene Sequence | TILANKKQSAMPWDQDPEQSTGNYSEDEQNGKQKWREEGEAGRKRE |
| Gene ID - Mouse | ENSMUSG00000040327 |
| Gene ID - Rat | ENSRNOG00000007850 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NANOGNB pAb (ATL-HPA060371) | |
| Datasheet | Anti NANOGNB pAb (ATL-HPA060371) Datasheet (External Link) |
| Vendor Page | Anti NANOGNB pAb (ATL-HPA060371) at Atlas Antibodies |
| Documents & Links for Anti NANOGNB pAb (ATL-HPA060371) | |
| Datasheet | Anti NANOGNB pAb (ATL-HPA060371) Datasheet (External Link) |
| Vendor Page | Anti NANOGNB pAb (ATL-HPA060371) |