Anti NAIP pAb (ATL-HPA042438)

Atlas Antibodies

Catalog No.:
ATL-HPA042438-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NLR family, apoptosis inhibitory protein
Gene Name: NAIP
Alternative Gene Name: BIRC1, NLRB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021640: 70%, ENSRNOG00000033693: 66%
Entrez Gene ID: 4671
Uniprot ID: Q13075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSGIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQD
Gene Sequence KSGIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQD
Gene ID - Mouse ENSMUSG00000021640
Gene ID - Rat ENSRNOG00000033693
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAIP pAb (ATL-HPA042438)
Datasheet Anti NAIP pAb (ATL-HPA042438) Datasheet (External Link)
Vendor Page Anti NAIP pAb (ATL-HPA042438) at Atlas Antibodies

Documents & Links for Anti NAIP pAb (ATL-HPA042438)
Datasheet Anti NAIP pAb (ATL-HPA042438) Datasheet (External Link)
Vendor Page Anti NAIP pAb (ATL-HPA042438)