Anti NAIF1 pAb (ATL-HPA064931)

Atlas Antibodies

Catalog No.: ATL-HPA064931-25

Protein Description: nuclear apoptosis inducing factor 1
Gene Name: NAIF1
Alternative Gene Name: bA379C10.2, C9orf90, DKFZp762G199
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039164: 94%, ENSRNOG00000050204: 96%
Entrez Gene ID: 203245
Uniprot ID: Q69YI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ
• Gene Sequence: EQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ
• Gene ID - Mouse: ENSMUSG00000039164
• Gene ID - Rat: ENSRNOG00000050204
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.