Anti NAGLU pAb (ATL-HPA038815)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038815-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NAGLU
Alternative Gene Name: NAG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001751: 89%, ENSRNOG00000032381: 89%
Entrez Gene ID: 4669
Uniprot ID: P54802
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LQGWLFQHQPQFWGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMA |
| Gene Sequence | LQGWLFQHQPQFWGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMA |
| Gene ID - Mouse | ENSMUSG00000001751 |
| Gene ID - Rat | ENSRNOG00000032381 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NAGLU pAb (ATL-HPA038815) | |
| Datasheet | Anti NAGLU pAb (ATL-HPA038815) Datasheet (External Link) |
| Vendor Page | Anti NAGLU pAb (ATL-HPA038815) at Atlas Antibodies |
| Documents & Links for Anti NAGLU pAb (ATL-HPA038815) | |
| Datasheet | Anti NAGLU pAb (ATL-HPA038815) Datasheet (External Link) |
| Vendor Page | Anti NAGLU pAb (ATL-HPA038815) |