Anti NAF1 pAb (ATL-HPA066090)

Atlas Antibodies

Catalog No.:
ATL-HPA066090-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nuclear assembly factor 1 ribonucleoprotein
Gene Name: NAF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014907: 69%, ENSRNOG00000026403: 73%
Entrez Gene ID: 92345
Uniprot ID: Q96HR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFNEPGEDFTEVHQNWNAHSSASEHAKGYRNREFTRGFSRARYPRSCHGRPPPQHFYNSEHMVSQETSGFPSQRQNNPIMPQYPF
Gene Sequence EFNEPGEDFTEVHQNWNAHSSASEHAKGYRNREFTRGFSRARYPRSCHGRPPPQHFYNSEHMVSQETSGFPSQRQNNPIMPQYPF
Gene ID - Mouse ENSMUSG00000014907
Gene ID - Rat ENSRNOG00000026403
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAF1 pAb (ATL-HPA066090)
Datasheet Anti NAF1 pAb (ATL-HPA066090) Datasheet (External Link)
Vendor Page Anti NAF1 pAb (ATL-HPA066090) at Atlas Antibodies

Documents & Links for Anti NAF1 pAb (ATL-HPA066090)
Datasheet Anti NAF1 pAb (ATL-HPA066090) Datasheet (External Link)
Vendor Page Anti NAF1 pAb (ATL-HPA066090)