Anti NACC2 pAb (ATL-HPA052962)

Atlas Antibodies

Catalog No.:
ATL-HPA052962-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NACC family member 2, BEN and BTB (POZ) domain containing
Gene Name: NACC2
Alternative Gene Name: BEND9, BTBD14A, BTBD31, MGC23427
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026932: 96%, ENSRNOG00000018231: 95%
Entrez Gene ID: 138151
Uniprot ID: Q96BF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRRDLVALPA
Gene Sequence DEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRRDLVALPA
Gene ID - Mouse ENSMUSG00000026932
Gene ID - Rat ENSRNOG00000018231
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NACC2 pAb (ATL-HPA052962)
Datasheet Anti NACC2 pAb (ATL-HPA052962) Datasheet (External Link)
Vendor Page Anti NACC2 pAb (ATL-HPA052962) at Atlas Antibodies

Documents & Links for Anti NACC2 pAb (ATL-HPA052962)
Datasheet Anti NACC2 pAb (ATL-HPA052962) Datasheet (External Link)
Vendor Page Anti NACC2 pAb (ATL-HPA052962)