Anti NACAD pAb (ATL-HPA079208 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA079208-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NAC alpha domain containing
Gene Name: NACAD
Alternative Gene Name: KIAA0363
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041073: 39%, ENSRNOG00000053875: 35%
Entrez Gene ID: 23148
Uniprot ID: O15069
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQVQQDDPQPAAEAGTPWAAQEDADSTLGMEALSLPEPASGAGEEIAEALSRPGREACLEARAHTGDGAKPDSPQKETLE
Gene Sequence DQVQQDDPQPAAEAGTPWAAQEDADSTLGMEALSLPEPASGAGEEIAEALSRPGREACLEARAHTGDGAKPDSPQKETLE
Gene ID - Mouse ENSMUSG00000041073
Gene ID - Rat ENSRNOG00000053875
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NACAD pAb (ATL-HPA079208 w/enhanced validation)
Datasheet Anti NACAD pAb (ATL-HPA079208 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NACAD pAb (ATL-HPA079208 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NACAD pAb (ATL-HPA079208 w/enhanced validation)
Datasheet Anti NACAD pAb (ATL-HPA079208 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NACAD pAb (ATL-HPA079208 w/enhanced validation)