Anti NACAD pAb (ATL-HPA079208 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA079208-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NACAD
Alternative Gene Name: KIAA0363
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041073: 39%, ENSRNOG00000053875: 35%
Entrez Gene ID: 23148
Uniprot ID: O15069
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DQVQQDDPQPAAEAGTPWAAQEDADSTLGMEALSLPEPASGAGEEIAEALSRPGREACLEARAHTGDGAKPDSPQKETLE |
| Gene Sequence | DQVQQDDPQPAAEAGTPWAAQEDADSTLGMEALSLPEPASGAGEEIAEALSRPGREACLEARAHTGDGAKPDSPQKETLE |
| Gene ID - Mouse | ENSMUSG00000041073 |
| Gene ID - Rat | ENSRNOG00000053875 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NACAD pAb (ATL-HPA079208 w/enhanced validation) | |
| Datasheet | Anti NACAD pAb (ATL-HPA079208 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NACAD pAb (ATL-HPA079208 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NACAD pAb (ATL-HPA079208 w/enhanced validation) | |
| Datasheet | Anti NACAD pAb (ATL-HPA079208 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NACAD pAb (ATL-HPA079208 w/enhanced validation) |