Anti NACA pAb (ATL-HPA073648)

Atlas Antibodies

Catalog No.:
ATL-HPA073648-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nascent polypeptide-associated complex alpha subunit
Gene Name: NACA
Alternative Gene Name: NACA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061315: 100%, ENSRNOG00000002632: 100%
Entrez Gene ID: 4666
Uniprot ID: Q13765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEV
Gene Sequence SQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEV
Gene ID - Mouse ENSMUSG00000061315
Gene ID - Rat ENSRNOG00000002632
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NACA pAb (ATL-HPA073648)
Datasheet Anti NACA pAb (ATL-HPA073648) Datasheet (External Link)
Vendor Page Anti NACA pAb (ATL-HPA073648) at Atlas Antibodies

Documents & Links for Anti NACA pAb (ATL-HPA073648)
Datasheet Anti NACA pAb (ATL-HPA073648) Datasheet (External Link)
Vendor Page Anti NACA pAb (ATL-HPA073648)