Anti NACA pAb (ATL-HPA073648)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073648-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NACA
Alternative Gene Name: NACA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061315: 100%, ENSRNOG00000002632: 100%
Entrez Gene ID: 4666
Uniprot ID: Q13765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEV |
Gene Sequence | SQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEV |
Gene ID - Mouse | ENSMUSG00000061315 |
Gene ID - Rat | ENSRNOG00000002632 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NACA pAb (ATL-HPA073648) | |
Datasheet | Anti NACA pAb (ATL-HPA073648) Datasheet (External Link) |
Vendor Page | Anti NACA pAb (ATL-HPA073648) at Atlas Antibodies |
Documents & Links for Anti NACA pAb (ATL-HPA073648) | |
Datasheet | Anti NACA pAb (ATL-HPA073648) Datasheet (External Link) |
Vendor Page | Anti NACA pAb (ATL-HPA073648) |