Anti NABP2 pAb (ATL-HPA057213)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057213-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NABP2
Alternative Gene Name: hSSB1, MGC2731, OBFC2B, SOSS-B1, SSB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025374: 74%, ENSRNOG00000023480: 76%
Entrez Gene ID: 79035
Uniprot ID: Q9BQ15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPS |
| Gene Sequence | FSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPS |
| Gene ID - Mouse | ENSMUSG00000025374 |
| Gene ID - Rat | ENSRNOG00000023480 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NABP2 pAb (ATL-HPA057213) | |
| Datasheet | Anti NABP2 pAb (ATL-HPA057213) Datasheet (External Link) |
| Vendor Page | Anti NABP2 pAb (ATL-HPA057213) at Atlas Antibodies |
| Documents & Links for Anti NABP2 pAb (ATL-HPA057213) | |
| Datasheet | Anti NABP2 pAb (ATL-HPA057213) Datasheet (External Link) |
| Vendor Page | Anti NABP2 pAb (ATL-HPA057213) |