Anti NAA50 pAb (ATL-HPA074489)

Atlas Antibodies

Catalog No.: ATL-HPA074489-100

Protein Description: N(alpha)-acetyltransferase 50, NatE catalytic subunit
Gene Name: NAA50
Alternative Gene Name: FLJ13194, MAK3, NAT13, NAT5, San
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022698: 100%, ENSRNOG00000039017: 100%
Entrez Gene ID: 80218
Uniprot ID: Q9GZZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF
• Gene Sequence: MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF
• Gene ID - Mouse: ENSMUSG00000022698
• Gene ID - Rat: ENSRNOG00000039017
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.