Anti NAA50 pAb (ATL-HPA074489)

Atlas Antibodies

Catalog No.:
ATL-HPA074489-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: N(alpha)-acetyltransferase 50, NatE catalytic subunit
Gene Name: NAA50
Alternative Gene Name: FLJ13194, MAK3, NAT13, NAT5, San
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022698: 100%, ENSRNOG00000039017: 100%
Entrez Gene ID: 80218
Uniprot ID: Q9GZZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF
Gene Sequence MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF
Gene ID - Mouse ENSMUSG00000022698
Gene ID - Rat ENSRNOG00000039017
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAA50 pAb (ATL-HPA074489)
Datasheet Anti NAA50 pAb (ATL-HPA074489) Datasheet (External Link)
Vendor Page Anti NAA50 pAb (ATL-HPA074489) at Atlas Antibodies

Documents & Links for Anti NAA50 pAb (ATL-HPA074489)
Datasheet Anti NAA50 pAb (ATL-HPA074489) Datasheet (External Link)
Vendor Page Anti NAA50 pAb (ATL-HPA074489)