Anti NAA35 pAb (ATL-HPA051586)

Atlas Antibodies

Catalog No.:
ATL-HPA051586-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: N(alpha)-acetyltransferase 35, NatC auxiliary subunit
Gene Name: NAA35
Alternative Gene Name: bA379P1.1, FLJ21613, FLJ22643, MAK10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021555: 92%, ENSRNOG00000018417: 92%
Entrez Gene ID: 60560
Uniprot ID: Q5VZE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDDDSGWELSMPEKMEKSNTNWVDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVL
Gene Sequence DDDDSGWELSMPEKMEKSNTNWVDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVL
Gene ID - Mouse ENSMUSG00000021555
Gene ID - Rat ENSRNOG00000018417
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAA35 pAb (ATL-HPA051586)
Datasheet Anti NAA35 pAb (ATL-HPA051586) Datasheet (External Link)
Vendor Page Anti NAA35 pAb (ATL-HPA051586) at Atlas Antibodies

Documents & Links for Anti NAA35 pAb (ATL-HPA051586)
Datasheet Anti NAA35 pAb (ATL-HPA051586) Datasheet (External Link)
Vendor Page Anti NAA35 pAb (ATL-HPA051586)