Anti NAA20 pAb (ATL-HPA063344)

Atlas Antibodies

Catalog No.:
ATL-HPA063344-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: N(alpha)-acetyltransferase 20, NatB catalytic subunit
Gene Name: NAA20
Alternative Gene Name: dJ1002M8.1, NAT3, NAT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002728: 100%, ENSRNOG00000010523: 100%
Entrez Gene ID: 51126
Uniprot ID: P61599
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
Gene Sequence LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
Gene ID - Mouse ENSMUSG00000002728
Gene ID - Rat ENSRNOG00000010523
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAA20 pAb (ATL-HPA063344)
Datasheet Anti NAA20 pAb (ATL-HPA063344) Datasheet (External Link)
Vendor Page Anti NAA20 pAb (ATL-HPA063344) at Atlas Antibodies

Documents & Links for Anti NAA20 pAb (ATL-HPA063344)
Datasheet Anti NAA20 pAb (ATL-HPA063344) Datasheet (External Link)
Vendor Page Anti NAA20 pAb (ATL-HPA063344)