Anti NAA20 pAb (ATL-HPA063344)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063344-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NAA20
Alternative Gene Name: dJ1002M8.1, NAT3, NAT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002728: 100%, ENSRNOG00000010523: 100%
Entrez Gene ID: 51126
Uniprot ID: P61599
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI |
Gene Sequence | LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI |
Gene ID - Mouse | ENSMUSG00000002728 |
Gene ID - Rat | ENSRNOG00000010523 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NAA20 pAb (ATL-HPA063344) | |
Datasheet | Anti NAA20 pAb (ATL-HPA063344) Datasheet (External Link) |
Vendor Page | Anti NAA20 pAb (ATL-HPA063344) at Atlas Antibodies |
Documents & Links for Anti NAA20 pAb (ATL-HPA063344) | |
Datasheet | Anti NAA20 pAb (ATL-HPA063344) Datasheet (External Link) |
Vendor Page | Anti NAA20 pAb (ATL-HPA063344) |