Anti NAA20 pAb (ATL-HPA063344)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063344-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NAA20
Alternative Gene Name: dJ1002M8.1, NAT3, NAT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002728: 100%, ENSRNOG00000010523: 100%
Entrez Gene ID: 51126
Uniprot ID: P61599
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI |
| Gene Sequence | LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI |
| Gene ID - Mouse | ENSMUSG00000002728 |
| Gene ID - Rat | ENSRNOG00000010523 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NAA20 pAb (ATL-HPA063344) | |
| Datasheet | Anti NAA20 pAb (ATL-HPA063344) Datasheet (External Link) |
| Vendor Page | Anti NAA20 pAb (ATL-HPA063344) at Atlas Antibodies |
| Documents & Links for Anti NAA20 pAb (ATL-HPA063344) | |
| Datasheet | Anti NAA20 pAb (ATL-HPA063344) Datasheet (External Link) |
| Vendor Page | Anti NAA20 pAb (ATL-HPA063344) |