Anti NAA20 pAb (ATL-HPA063344)

Atlas Antibodies

SKU: ATL-HPA063344-25

• 

Protein Description: N(alpha)-acetyltransferase 20, NatB catalytic subunit
Gene Name: NAA20
Alternative Gene Name: dJ1002M8.1, NAT3, NAT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002728: 100%, ENSRNOG00000010523: 100%
Entrez Gene ID: 51126
Uniprot ID: P61599
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
• Gene Sequence: LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
• Gene ID - Mouse: ENSMUSG00000002728
• Gene ID - Rat: ENSRNOG00000010523
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.