Anti NAA15 pAb (ATL-HPA050661)

Atlas Antibodies

Catalog No.:
ATL-HPA050661-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: N(alpha)-acetyltransferase 15, NatA auxiliary subunit
Gene Name: NAA15
Alternative Gene Name: FLJ13340, NARG1, NATH, TBDN100
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063273: 96%, ENSRNOG00000012385: 93%
Entrez Gene ID: 80155
Uniprot ID: Q9BXJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMPPGYEEDMKITVN
Gene Sequence RTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMPPGYEEDMKITVN
Gene ID - Mouse ENSMUSG00000063273
Gene ID - Rat ENSRNOG00000012385
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAA15 pAb (ATL-HPA050661)
Datasheet Anti NAA15 pAb (ATL-HPA050661) Datasheet (External Link)
Vendor Page Anti NAA15 pAb (ATL-HPA050661) at Atlas Antibodies

Documents & Links for Anti NAA15 pAb (ATL-HPA050661)
Datasheet Anti NAA15 pAb (ATL-HPA050661) Datasheet (External Link)
Vendor Page Anti NAA15 pAb (ATL-HPA050661)