Anti N6AMT1 pAb (ATL-HPA059242)
Atlas Antibodies
- SKU:
- ATL-HPA059242-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: N6AMT1
Alternative Gene Name: C21orf127, HEMK2, MTQ2, N6AMT, PRED28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044442: 85%, ENSRNOG00000001603: 88%
Entrez Gene ID: 29104
Uniprot ID: Q9Y5N5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT |
Gene Sequence | GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT |
Gene ID - Mouse | ENSMUSG00000044442 |
Gene ID - Rat | ENSRNOG00000001603 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti N6AMT1 pAb (ATL-HPA059242) | |
Datasheet | Anti N6AMT1 pAb (ATL-HPA059242) Datasheet (External Link) |
Vendor Page | Anti N6AMT1 pAb (ATL-HPA059242) at Atlas Antibodies |
Documents & Links for Anti N6AMT1 pAb (ATL-HPA059242) | |
Datasheet | Anti N6AMT1 pAb (ATL-HPA059242) Datasheet (External Link) |
Vendor Page | Anti N6AMT1 pAb (ATL-HPA059242) |
Citations for Anti N6AMT1 pAb (ATL-HPA059242) – 1 Found |
Brūmele, Baiba; Mutso, Margit; Telanne, Lilian; Õunap, Kadri; Spunde, Karīna; Abroi, Aare; Kurg, Reet. Human TRMT112-Methyltransferase Network Consists of Seven Partners Interacting with a Common Co-Factor. International Journal Of Molecular Sciences. 2021;22(24) PubMed |