Anti N6AMT1 pAb (ATL-HPA059242)

Atlas Antibodies

Catalog No.: ATL-HPA059242-25

Protein Description: N-6 adenine-specific DNA methyltransferase 1 (putative)
Gene Name: N6AMT1
Alternative Gene Name: C21orf127, HEMK2, MTQ2, N6AMT, PRED28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044442: 85%, ENSRNOG00000001603: 88%
Entrez Gene ID: 29104
Uniprot ID: Q9Y5N5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT
• Gene Sequence: GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT
• Gene ID - Mouse: ENSMUSG00000044442
• Gene ID - Rat: ENSRNOG00000001603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti N6AMT1 pAb (ATL-HPA059242) – 1 Found

Brūmele, Baiba; Mutso, Margit; Telanne, Lilian; Õunap, Kadri; Spunde, Karīna; Abroi, Aare; Kurg, Reet. Human TRMT112-Methyltransferase Network Consists of Seven Partners Interacting with a Common Co-Factor. International Journal Of Molecular Sciences. 2021;22(24)