Anti N6AMT1 pAb (ATL-HPA059242)

Atlas Antibodies

Catalog No.:
ATL-HPA059242-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: N-6 adenine-specific DNA methyltransferase 1 (putative)
Gene Name: N6AMT1
Alternative Gene Name: C21orf127, HEMK2, MTQ2, N6AMT, PRED28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044442: 85%, ENSRNOG00000001603: 88%
Entrez Gene ID: 29104
Uniprot ID: Q9Y5N5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT
Gene Sequence GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT
Gene ID - Mouse ENSMUSG00000044442
Gene ID - Rat ENSRNOG00000001603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti N6AMT1 pAb (ATL-HPA059242)
Datasheet Anti N6AMT1 pAb (ATL-HPA059242) Datasheet (External Link)
Vendor Page Anti N6AMT1 pAb (ATL-HPA059242) at Atlas Antibodies

Documents & Links for Anti N6AMT1 pAb (ATL-HPA059242)
Datasheet Anti N6AMT1 pAb (ATL-HPA059242) Datasheet (External Link)
Vendor Page Anti N6AMT1 pAb (ATL-HPA059242)
Citations for Anti N6AMT1 pAb (ATL-HPA059242) – 1 Found
Brūmele, Baiba; Mutso, Margit; Telanne, Lilian; Õunap, Kadri; Spunde, Karīna; Abroi, Aare; Kurg, Reet. Human TRMT112-Methyltransferase Network Consists of Seven Partners Interacting with a Common Co-Factor. International Journal Of Molecular Sciences. 2021;22(24)  PubMed