Anti MZB1 pAb (ATL-HPA043745 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043745-100

Protein Description: marginal zone B and B1 cell-specific protein
Gene Name: MZB1
Alternative Gene Name: HSPC190, MEDA-7, MGC29506, PACAP, pERp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024353: 73%, ENSRNOG00000022009: 74%
Entrez Gene ID: 51237
Uniprot ID: Q8WU39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATR
• Gene Sequence: YGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATR
• Gene ID - Mouse: ENSMUSG00000024353
• Gene ID - Rat: ENSRNOG00000022009
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MZB1 pAb (ATL-HPA043745 w/enhanced validation) – 1 Found

Persson Skare, Tor; Sjöberg, Elin; Berglund, Mattias; Smith, Ross O; Roche, Francis P; Lindskog, Cecilia; Sander, Birgitta; Glimelius, Ingrid; Gholiha, Alex R; Enblad, Gunilla; Amini, Rose-Marie; Claesson-Welsh, Lena. Marginal zone lymphoma expression of histidine-rich glycoprotein correlates with improved survival. Ejhaem. 2020;1(1):199-207.