Anti MYT1L pAb (ATL-HPA060245)

Atlas Antibodies

Catalog No.:
ATL-HPA060245-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: myelin transcription factor 1 like
Gene Name: MYT1L
Alternative Gene Name: KIAA1106, NZF1, ZC2H2C2, ZC2HC4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061911: 95%, ENSRNOG00000004269: 95%
Entrez Gene ID: 23040
Uniprot ID: Q9UL68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNSDRSEEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKPKSSDSHVK
Gene Sequence VNSDRSEEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKPKSSDSHVK
Gene ID - Mouse ENSMUSG00000061911
Gene ID - Rat ENSRNOG00000004269
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYT1L pAb (ATL-HPA060245)
Datasheet Anti MYT1L pAb (ATL-HPA060245) Datasheet (External Link)
Vendor Page Anti MYT1L pAb (ATL-HPA060245) at Atlas Antibodies

Documents & Links for Anti MYT1L pAb (ATL-HPA060245)
Datasheet Anti MYT1L pAb (ATL-HPA060245) Datasheet (External Link)
Vendor Page Anti MYT1L pAb (ATL-HPA060245)