Anti MYSM1 pAb (ATL-HPA067133)

Atlas Antibodies

Catalog No.:
ATL-HPA067133-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Myb-like, SWIRM and MPN domains 1
Gene Name: MYSM1
Alternative Gene Name: KIAA1915
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062627: 92%, ENSRNOG00000026299: 92%
Entrez Gene ID: 114803
Uniprot ID: Q5VVJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNCIGRIHTYLELIGAINFGCEQAVYNRPQTVDKVRIRDRKDAVEAYQLAQRLQSMRTRRRRVRDPWGNWCDAKDLEGQTFEHLS
Gene Sequence VNCIGRIHTYLELIGAINFGCEQAVYNRPQTVDKVRIRDRKDAVEAYQLAQRLQSMRTRRRRVRDPWGNWCDAKDLEGQTFEHLS
Gene ID - Mouse ENSMUSG00000062627
Gene ID - Rat ENSRNOG00000026299
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYSM1 pAb (ATL-HPA067133)
Datasheet Anti MYSM1 pAb (ATL-HPA067133) Datasheet (External Link)
Vendor Page Anti MYSM1 pAb (ATL-HPA067133) at Atlas Antibodies

Documents & Links for Anti MYSM1 pAb (ATL-HPA067133)
Datasheet Anti MYSM1 pAb (ATL-HPA067133) Datasheet (External Link)
Vendor Page Anti MYSM1 pAb (ATL-HPA067133)