Anti MYOCD pAb (ATL-HPA071528)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA071528-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $303.00
    
         
                            Gene Name: MYOCD
Alternative Gene Name: MYCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020542: 73%, ENSRNOG00000003669: 75%
Entrez Gene ID: 93649
Uniprot ID: Q8IZQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | ANQGIIPPLKRPAEFHEQRKHLDSDKAKNSLKRKARNRCNSADLVNMHILQASTAERSIPTAQM | 
| Gene Sequence | ANQGIIPPLKRPAEFHEQRKHLDSDKAKNSLKRKARNRCNSADLVNMHILQASTAERSIPTAQM | 
| Gene ID - Mouse | ENSMUSG00000020542 | 
| Gene ID - Rat | ENSRNOG00000003669 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti MYOCD pAb (ATL-HPA071528) | |
| Datasheet | Anti MYOCD pAb (ATL-HPA071528) Datasheet (External Link) | 
| Vendor Page | Anti MYOCD pAb (ATL-HPA071528) at Atlas Antibodies | 
| Documents & Links for Anti MYOCD pAb (ATL-HPA071528) | |
| Datasheet | Anti MYOCD pAb (ATL-HPA071528) Datasheet (External Link) | 
| Vendor Page | Anti MYOCD pAb (ATL-HPA071528) |