Anti MYOCD pAb (ATL-HPA071528)

Atlas Antibodies

Catalog No.:
ATL-HPA071528-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: myocardin
Gene Name: MYOCD
Alternative Gene Name: MYCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020542: 73%, ENSRNOG00000003669: 75%
Entrez Gene ID: 93649
Uniprot ID: Q8IZQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANQGIIPPLKRPAEFHEQRKHLDSDKAKNSLKRKARNRCNSADLVNMHILQASTAERSIPTAQM
Gene Sequence ANQGIIPPLKRPAEFHEQRKHLDSDKAKNSLKRKARNRCNSADLVNMHILQASTAERSIPTAQM
Gene ID - Mouse ENSMUSG00000020542
Gene ID - Rat ENSRNOG00000003669
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYOCD pAb (ATL-HPA071528)
Datasheet Anti MYOCD pAb (ATL-HPA071528) Datasheet (External Link)
Vendor Page Anti MYOCD pAb (ATL-HPA071528) at Atlas Antibodies

Documents & Links for Anti MYOCD pAb (ATL-HPA071528)
Datasheet Anti MYOCD pAb (ATL-HPA071528) Datasheet (External Link)
Vendor Page Anti MYOCD pAb (ATL-HPA071528)