Anti MYOC pAb (ATL-HPA027364)

Atlas Antibodies

Catalog No.: ATL-HPA027364-25

Protein Description: myocilin, trabecular meshwork inducible glucocorticoid response
Gene Name: MYOC
Alternative Gene Name: GLC1A, JOAG1, TIGR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026697: 79%, ENSRNOG00000003221: 79%
Entrez Gene ID: 4653
Uniprot ID: Q99972
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRIL
• Gene Sequence: NLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRIL
• Gene ID - Mouse: ENSMUSG00000026697
• Gene ID - Rat: ENSRNOG00000003221
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYOC pAb (ATL-HPA027364) – 1 Found

Lynch, Jeffrey M; Li, Bing; Katoli, Parvaneh; Xiang, Chuanxi; Leehy, Barrett; Rangaswamy, Nalini; Saenz-Vash, Veronica; Wang, Y Karen; Lei, Hong; Nicholson, Thomas B; Meredith, Erik; Rice, Dennis S; Prasanna, Ganesh; Chen, Amy. Binding of a glaucoma-associated myocilin variant to the αB-crystallin chaperone impedes protein clearance in trabecular meshwork cells. The Journal Of Biological Chemistry. 2018;293(52):20137-20156.