Anti MYO1B pAb (ATL-HPA060144)

Atlas Antibodies

SKU:
ATL-HPA060144-25
  • Immunohistochemical staining of human liver shows moderate membranous positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line PC-3
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: myosin IB
Gene Name: MYO1B
Alternative Gene Name: myr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018417: 100%, ENSRNOG00000048152: 100%
Entrez Gene ID: 4430
Uniprot ID: O43795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFR
Gene Sequence EVVNKINRANGKSTSRIFLLTNNNLLLADQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFR
Gene ID - Mouse ENSMUSG00000018417
Gene ID - Rat ENSRNOG00000048152
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MYO1B pAb (ATL-HPA060144)
Datasheet Anti MYO1B pAb (ATL-HPA060144) Datasheet (External Link)
Vendor Page Anti MYO1B pAb (ATL-HPA060144) at Atlas Antibodies

Documents & Links for Anti MYO1B pAb (ATL-HPA060144)
Datasheet Anti MYO1B pAb (ATL-HPA060144) Datasheet (External Link)
Vendor Page Anti MYO1B pAb (ATL-HPA060144)