Anti MYO19 pAb (ATL-HPA059715)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059715-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MYO19
Alternative Gene Name: FLJ22865, MYOHD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020527: 94%, ENSRNOG00000002852: 91%
Entrez Gene ID: 80179
Uniprot ID: Q96H55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FYQICKGASEDERLQWHLPEGAAFSWLPNPERSLEEDCFEVTREAMLHLGIDTPTQNNIFKVLAGLL |
Gene Sequence | FYQICKGASEDERLQWHLPEGAAFSWLPNPERSLEEDCFEVTREAMLHLGIDTPTQNNIFKVLAGLL |
Gene ID - Mouse | ENSMUSG00000020527 |
Gene ID - Rat | ENSRNOG00000002852 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MYO19 pAb (ATL-HPA059715) | |
Datasheet | Anti MYO19 pAb (ATL-HPA059715) Datasheet (External Link) |
Vendor Page | Anti MYO19 pAb (ATL-HPA059715) at Atlas Antibodies |
Documents & Links for Anti MYO19 pAb (ATL-HPA059715) | |
Datasheet | Anti MYO19 pAb (ATL-HPA059715) Datasheet (External Link) |
Vendor Page | Anti MYO19 pAb (ATL-HPA059715) |
Citations for Anti MYO19 pAb (ATL-HPA059715) – 1 Found |
Shi, Peng; Ren, Xiaoyu; Meng, Jie; Kang, Chenlu; Wu, Yihe; Rong, Yingxue; Zhao, Shujuan; Jiang, Zhaodi; Liang, Ling; He, Wanzhong; Yin, Yuxin; Li, Xiangdong; Liu, Yong; Huang, Xiaoshuai; Sun, Yujie; Li, Bo; Wu, Congying. Mechanical instability generated by Myosin 19 contributes to mitochondria cristae architecture and OXPHOS. Nature Communications. 2022;13(1):2673. PubMed |