Anti MYL3 pAb (ATL-HPA063034)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063034-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MYL3
Alternative Gene Name: CMH8, MLC1SB, MLC1V, VLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090841: 100%, ENSRNOG00000054140: 100%
Entrez Gene ID: 4634
Uniprot ID: P08590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR |
Gene Sequence | AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR |
Gene ID - Mouse | ENSMUSG00000090841 |
Gene ID - Rat | ENSRNOG00000054140 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MYL3 pAb (ATL-HPA063034) | |
Datasheet | Anti MYL3 pAb (ATL-HPA063034) Datasheet (External Link) |
Vendor Page | Anti MYL3 pAb (ATL-HPA063034) at Atlas Antibodies |
Documents & Links for Anti MYL3 pAb (ATL-HPA063034) | |
Datasheet | Anti MYL3 pAb (ATL-HPA063034) Datasheet (External Link) |
Vendor Page | Anti MYL3 pAb (ATL-HPA063034) |