Anti MYL3 pAb (ATL-HPA063034)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063034-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MYL3
Alternative Gene Name: CMH8, MLC1SB, MLC1V, VLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090841: 100%, ENSRNOG00000054140: 100%
Entrez Gene ID: 4634
Uniprot ID: P08590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR |
| Gene Sequence | AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR |
| Gene ID - Mouse | ENSMUSG00000090841 |
| Gene ID - Rat | ENSRNOG00000054140 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MYL3 pAb (ATL-HPA063034) | |
| Datasheet | Anti MYL3 pAb (ATL-HPA063034) Datasheet (External Link) |
| Vendor Page | Anti MYL3 pAb (ATL-HPA063034) at Atlas Antibodies |
| Documents & Links for Anti MYL3 pAb (ATL-HPA063034) | |
| Datasheet | Anti MYL3 pAb (ATL-HPA063034) Datasheet (External Link) |
| Vendor Page | Anti MYL3 pAb (ATL-HPA063034) |