Anti MYL3 pAb (ATL-HPA063034)

Atlas Antibodies

SKU:
ATL-HPA063034-25
  • Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: myosin, light chain 3, alkali; ventricular, skeletal, slow
Gene Name: MYL3
Alternative Gene Name: CMH8, MLC1SB, MLC1V, VLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090841: 100%, ENSRNOG00000054140: 100%
Entrez Gene ID: 4634
Uniprot ID: P08590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR
Gene Sequence AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR
Gene ID - Mouse ENSMUSG00000090841
Gene ID - Rat ENSRNOG00000054140
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MYL3 pAb (ATL-HPA063034)
Datasheet Anti MYL3 pAb (ATL-HPA063034) Datasheet (External Link)
Vendor Page Anti MYL3 pAb (ATL-HPA063034) at Atlas Antibodies

Documents & Links for Anti MYL3 pAb (ATL-HPA063034)
Datasheet Anti MYL3 pAb (ATL-HPA063034) Datasheet (External Link)
Vendor Page Anti MYL3 pAb (ATL-HPA063034)