Anti MYH3 pAb (ATL-HPA021808)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021808-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MYH3
Alternative Gene Name: HEMHC, MYHC-EMB, MYHSE1, SMHCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020908: 96%, ENSRNOG00000046276: 99%
Entrez Gene ID: 4621
Uniprot ID: P11055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAML |
| Gene Sequence | IEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAML |
| Gene ID - Mouse | ENSMUSG00000020908 |
| Gene ID - Rat | ENSRNOG00000046276 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MYH3 pAb (ATL-HPA021808) | |
| Datasheet | Anti MYH3 pAb (ATL-HPA021808) Datasheet (External Link) |
| Vendor Page | Anti MYH3 pAb (ATL-HPA021808) at Atlas Antibodies |
| Documents & Links for Anti MYH3 pAb (ATL-HPA021808) | |
| Datasheet | Anti MYH3 pAb (ATL-HPA021808) Datasheet (External Link) |
| Vendor Page | Anti MYH3 pAb (ATL-HPA021808) |
| Citations for Anti MYH3 pAb (ATL-HPA021808) – 3 Found |
| Yoon, Soonsang; Beermann, Mary Lou; Yu, Bryant; Shao, Di; Bachschmid, Markus; Miller, Jeffrey Boone. Aberrant Caspase Activation in Laminin-α2-Deficient Human Myogenic Cells is Mediated by p53 and Sirtuin Activity. Journal Of Neuromuscular Diseases. 5(1):59-73. PubMed |
| Song, Taejeong; Manoharan, Palanikumar; Millay, Douglas P; Koch, Sheryl E; Rubinstein, Jack; Heiny, Judith A; Sadayappan, Sakthivel. Dilated cardiomyopathy-mediated heart failure induces a unique skeletal muscle myopathy with inflammation. Skeletal Muscle. 2019;9(1):4. PubMed |
| Homma, Sachiko; Beermann, Mary Lou; Yu, Bryant; Boyce, Frederick M; Miller, Jeffrey Boone. Nuclear bodies reorganize during myogenesis in vitro and are differentially disrupted by expression of FSHD-associated DUX4. Skeletal Muscle. 2016;6(1):42. PubMed |