Anti MYH3 pAb (ATL-HPA021808)

Atlas Antibodies

Catalog No.:
ATL-HPA021808-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: myosin, heavy chain 3, skeletal muscle, embryonic
Gene Name: MYH3
Alternative Gene Name: HEMHC, MYHC-EMB, MYHSE1, SMHCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020908: 96%, ENSRNOG00000046276: 99%
Entrez Gene ID: 4621
Uniprot ID: P11055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAML
Gene Sequence IEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAML
Gene ID - Mouse ENSMUSG00000020908
Gene ID - Rat ENSRNOG00000046276
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYH3 pAb (ATL-HPA021808)
Datasheet Anti MYH3 pAb (ATL-HPA021808) Datasheet (External Link)
Vendor Page Anti MYH3 pAb (ATL-HPA021808) at Atlas Antibodies

Documents & Links for Anti MYH3 pAb (ATL-HPA021808)
Datasheet Anti MYH3 pAb (ATL-HPA021808) Datasheet (External Link)
Vendor Page Anti MYH3 pAb (ATL-HPA021808)
Citations for Anti MYH3 pAb (ATL-HPA021808) – 3 Found
Yoon, Soonsang; Beermann, Mary Lou; Yu, Bryant; Shao, Di; Bachschmid, Markus; Miller, Jeffrey Boone. Aberrant Caspase Activation in Laminin-α2-Deficient Human Myogenic Cells is Mediated by p53 and Sirtuin Activity. Journal Of Neuromuscular Diseases. 5(1):59-73.  PubMed
Song, Taejeong; Manoharan, Palanikumar; Millay, Douglas P; Koch, Sheryl E; Rubinstein, Jack; Heiny, Judith A; Sadayappan, Sakthivel. Dilated cardiomyopathy-mediated heart failure induces a unique skeletal muscle myopathy with inflammation. Skeletal Muscle. 2019;9(1):4.  PubMed
Homma, Sachiko; Beermann, Mary Lou; Yu, Bryant; Boyce, Frederick M; Miller, Jeffrey Boone. Nuclear bodies reorganize during myogenesis in vitro and are differentially disrupted by expression of FSHD-associated DUX4. Skeletal Muscle. 2016;6(1):42.  PubMed