Anti MYH15 pAb (ATL-HPA057915)

Atlas Antibodies

Catalog No.:
ATL-HPA057915-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: myosin heavy chain 15
Gene Name: MYH15
Alternative Gene Name: KIAA1000
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092009: 69%, ENSRNOG00000061038: 69%
Entrez Gene ID: 22989
Uniprot ID: Q9Y2K3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGEAAAFLRRSEAELLLLQATALDGKKKCWIPDGENAYIEAEVKGSEDDGTVIVETADGESLSIKEDKIQQMNPPEFE
Gene Sequence LGEAAAFLRRSEAELLLLQATALDGKKKCWIPDGENAYIEAEVKGSEDDGTVIVETADGESLSIKEDKIQQMNPPEFE
Gene ID - Mouse ENSMUSG00000092009
Gene ID - Rat ENSRNOG00000061038
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYH15 pAb (ATL-HPA057915)
Datasheet Anti MYH15 pAb (ATL-HPA057915) Datasheet (External Link)
Vendor Page Anti MYH15 pAb (ATL-HPA057915) at Atlas Antibodies

Documents & Links for Anti MYH15 pAb (ATL-HPA057915)
Datasheet Anti MYH15 pAb (ATL-HPA057915) Datasheet (External Link)
Vendor Page Anti MYH15 pAb (ATL-HPA057915)