Anti MYH14 pAb (ATL-HPA062391)

Atlas Antibodies

Catalog No.:
ATL-HPA062391-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: myosin, heavy chain 14, non-muscle
Gene Name: MYH14
Alternative Gene Name: DFNA4, FLJ13881, KIAA2034, MHC16, MYH17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030739: 94%, ENSRNOG00000020014: 92%
Entrez Gene ID: 79784
Uniprot ID: Q7Z406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE
Gene Sequence GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE
Gene ID - Mouse ENSMUSG00000030739
Gene ID - Rat ENSRNOG00000020014
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYH14 pAb (ATL-HPA062391)
Datasheet Anti MYH14 pAb (ATL-HPA062391) Datasheet (External Link)
Vendor Page Anti MYH14 pAb (ATL-HPA062391) at Atlas Antibodies

Documents & Links for Anti MYH14 pAb (ATL-HPA062391)
Datasheet Anti MYH14 pAb (ATL-HPA062391) Datasheet (External Link)
Vendor Page Anti MYH14 pAb (ATL-HPA062391)