Anti MYH14 pAb (ATL-HPA062391)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062391-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MYH14
Alternative Gene Name: DFNA4, FLJ13881, KIAA2034, MHC16, MYH17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030739: 94%, ENSRNOG00000020014: 92%
Entrez Gene ID: 79784
Uniprot ID: Q7Z406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE |
| Gene Sequence | GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE |
| Gene ID - Mouse | ENSMUSG00000030739 |
| Gene ID - Rat | ENSRNOG00000020014 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MYH14 pAb (ATL-HPA062391) | |
| Datasheet | Anti MYH14 pAb (ATL-HPA062391) Datasheet (External Link) |
| Vendor Page | Anti MYH14 pAb (ATL-HPA062391) at Atlas Antibodies |
| Documents & Links for Anti MYH14 pAb (ATL-HPA062391) | |
| Datasheet | Anti MYH14 pAb (ATL-HPA062391) Datasheet (External Link) |
| Vendor Page | Anti MYH14 pAb (ATL-HPA062391) |