Anti MYH11 pAb (ATL-HPA014539 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014539-25

Protein Description: myosin, heavy chain 11, smooth muscle
Gene Name: MYH11
Alternative Gene Name: SMHC, SMMHC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018830: 90%, ENSRNOG00000057880: 89%
Entrez Gene ID: 4629
Uniprot ID: P35749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEK
• Gene Sequence: LQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEK
• Gene ID - Mouse: ENSMUSG00000018830
• Gene ID - Rat: ENSRNOG00000057880
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYH11 pAb (ATL-HPA014539 w/enhanced validation) – 1 Found

Mao, Yang; Liu, Xiao Qiong; Song, Yu; Zhai, Chun Gang; Xu, Xing Li; Zhang, Lei; Zhang, Yun. Fibroblast growth factor-2/platelet-derived growth factor enhances atherosclerotic plaque stability. Journal Of Cellular And Molecular Medicine. 2020;24(1):1128-1140.