Anti MYH11 pAb (ATL-HPA014539 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014539-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MYH11
Alternative Gene Name: SMHC, SMMHC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018830: 90%, ENSRNOG00000057880: 89%
Entrez Gene ID: 4629
Uniprot ID: P35749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEK |
| Gene Sequence | LQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEK |
| Gene ID - Mouse | ENSMUSG00000018830 |
| Gene ID - Rat | ENSRNOG00000057880 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MYH11 pAb (ATL-HPA014539 w/enhanced validation) | |
| Datasheet | Anti MYH11 pAb (ATL-HPA014539 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MYH11 pAb (ATL-HPA014539 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MYH11 pAb (ATL-HPA014539 w/enhanced validation) | |
| Datasheet | Anti MYH11 pAb (ATL-HPA014539 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MYH11 pAb (ATL-HPA014539 w/enhanced validation) |
| Citations for Anti MYH11 pAb (ATL-HPA014539 w/enhanced validation) – 1 Found |
| Mao, Yang; Liu, Xiao Qiong; Song, Yu; Zhai, Chun Gang; Xu, Xing Li; Zhang, Lei; Zhang, Yun. Fibroblast growth factor-2/platelet-derived growth factor enhances atherosclerotic plaque stability. Journal Of Cellular And Molecular Medicine. 2020;24(1):1128-1140. PubMed |