Anti MYCN pAb (ATL-HPA057420)

Atlas Antibodies

Catalog No.:
ATL-HPA057420-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog
Gene Name: MYCN
Alternative Gene Name: bHLHe37, MYCNOT, N-myc, NMYC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037169: 87%, ENSRNOG00000051372: 87%
Entrez Gene ID: 4613
Uniprot ID: P04198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAA
Gene Sequence VEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAA
Gene ID - Mouse ENSMUSG00000037169
Gene ID - Rat ENSRNOG00000051372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYCN pAb (ATL-HPA057420)
Datasheet Anti MYCN pAb (ATL-HPA057420) Datasheet (External Link)
Vendor Page Anti MYCN pAb (ATL-HPA057420) at Atlas Antibodies

Documents & Links for Anti MYCN pAb (ATL-HPA057420)
Datasheet Anti MYCN pAb (ATL-HPA057420) Datasheet (External Link)
Vendor Page Anti MYCN pAb (ATL-HPA057420)