Anti MYCN pAb (ATL-HPA057420)

Atlas Antibodies

Catalog No.: ATL-HPA057420-25

Protein Description: v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog
Gene Name: MYCN
Alternative Gene Name: bHLHe37, MYCNOT, N-myc, NMYC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037169: 87%, ENSRNOG00000051372: 87%
Entrez Gene ID: 4613
Uniprot ID: P04198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAA
• Gene Sequence: VEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAA
• Gene ID - Mouse: ENSMUSG00000037169
• Gene ID - Rat: ENSRNOG00000051372
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.