Anti MYCL pAb (ATL-HPA063132)

Atlas Antibodies

SKU:
ATL-HPA063132-100
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleus.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: v-myc avian myelocytomatosis viral oncogene lung carcinoma derived homolog
Gene Name: MYCL
Alternative Gene Name: bHLHe38, LMYC, MYCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028654: 86%, ENSRNOG00000014259: 86%
Entrez Gene ID: 4610
Uniprot ID: P12524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYAS
Gene Sequence FELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYAS
Gene ID - Mouse ENSMUSG00000028654
Gene ID - Rat ENSRNOG00000014259
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MYCL pAb (ATL-HPA063132)
Datasheet Anti MYCL pAb (ATL-HPA063132) Datasheet (External Link)
Vendor Page Anti MYCL pAb (ATL-HPA063132) at Atlas Antibodies

Documents & Links for Anti MYCL pAb (ATL-HPA063132)
Datasheet Anti MYCL pAb (ATL-HPA063132) Datasheet (External Link)
Vendor Page Anti MYCL pAb (ATL-HPA063132)