Anti MYCL pAb (ATL-HPA063132)
Atlas Antibodies
- SKU:
- ATL-HPA063132-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: MYCL
Alternative Gene Name: bHLHe38, LMYC, MYCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028654: 86%, ENSRNOG00000014259: 86%
Entrez Gene ID: 4610
Uniprot ID: P12524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYAS |
Gene Sequence | FELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYAS |
Gene ID - Mouse | ENSMUSG00000028654 |
Gene ID - Rat | ENSRNOG00000014259 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MYCL pAb (ATL-HPA063132) | |
Datasheet | Anti MYCL pAb (ATL-HPA063132) Datasheet (External Link) |
Vendor Page | Anti MYCL pAb (ATL-HPA063132) at Atlas Antibodies |
Documents & Links for Anti MYCL pAb (ATL-HPA063132) | |
Datasheet | Anti MYCL pAb (ATL-HPA063132) Datasheet (External Link) |
Vendor Page | Anti MYCL pAb (ATL-HPA063132) |