Anti MYCBP2 pAb (ATL-HPA058807)
Atlas Antibodies
- SKU:
- ATL-HPA058807-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MYCBP2
Alternative Gene Name: FLJ10106, KIAA0916, PAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033004: 98%, ENSRNOG00000010479: 97%
Entrez Gene ID: 23077
Uniprot ID: O75592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CYHPAKPFQSQLPSVKEGISEDLPVKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPESNMKSMPPSL |
Gene Sequence | CYHPAKPFQSQLPSVKEGISEDLPVKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPESNMKSMPPSL |
Gene ID - Mouse | ENSMUSG00000033004 |
Gene ID - Rat | ENSRNOG00000010479 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MYCBP2 pAb (ATL-HPA058807) | |
Datasheet | Anti MYCBP2 pAb (ATL-HPA058807) Datasheet (External Link) |
Vendor Page | Anti MYCBP2 pAb (ATL-HPA058807) at Atlas Antibodies |
Documents & Links for Anti MYCBP2 pAb (ATL-HPA058807) | |
Datasheet | Anti MYCBP2 pAb (ATL-HPA058807) Datasheet (External Link) |
Vendor Page | Anti MYCBP2 pAb (ATL-HPA058807) |
Citations for Anti MYCBP2 pAb (ATL-HPA058807) – 1 Found |
Yuan, Gongsheng; Yang, Shuting; Yang, Shuying. RGS12 represses oral squamous cell carcinoma by driving M1 polarization of tumor-associated macrophages via controlling ciliary MYCBP2/KIF2A signaling. International Journal Of Oral Science. 2023;15(1):11. PubMed |