Anti MYBPHL pAb (ATL-HPA077633)

Atlas Antibodies

Catalog No.:
ATL-HPA077633-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: myosin binding protein H like
Gene Name: MYBPHL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068745: 88%, ENSRNOG00000037082: 88%
Entrez Gene ID: 343263
Uniprot ID: A2RUH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQCGLSETAPITTDLAHIQKAATVYKTKGFAQRD
Gene Sequence NQCGLSETAPITTDLAHIQKAATVYKTKGFAQRD
Gene ID - Mouse ENSMUSG00000068745
Gene ID - Rat ENSRNOG00000037082
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYBPHL pAb (ATL-HPA077633)
Datasheet Anti MYBPHL pAb (ATL-HPA077633) Datasheet (External Link)
Vendor Page Anti MYBPHL pAb (ATL-HPA077633) at Atlas Antibodies

Documents & Links for Anti MYBPHL pAb (ATL-HPA077633)
Datasheet Anti MYBPHL pAb (ATL-HPA077633) Datasheet (External Link)
Vendor Page Anti MYBPHL pAb (ATL-HPA077633)