Anti MYBPC2 pAb (ATL-HPA046745 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA046745-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: myosin binding protein C, fast type
Gene Name: MYBPC2
Alternative Gene Name: MGC163408, MYBPC, MYBPCF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038670: 95%, ENSRNOG00000019627: 95%
Entrez Gene ID: 4606
Uniprot ID: Q14324
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFV
Gene Sequence RTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFV
Gene ID - Mouse ENSMUSG00000038670
Gene ID - Rat ENSRNOG00000019627
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYBPC2 pAb (ATL-HPA046745 w/enhanced validation)
Datasheet Anti MYBPC2 pAb (ATL-HPA046745 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MYBPC2 pAb (ATL-HPA046745 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MYBPC2 pAb (ATL-HPA046745 w/enhanced validation)
Datasheet Anti MYBPC2 pAb (ATL-HPA046745 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MYBPC2 pAb (ATL-HPA046745 w/enhanced validation)