Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021004-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MYBPC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020061: 85%, ENSRNOG00000056493: 86%
Entrez Gene ID: 4604
Uniprot ID: Q00872
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN |
| Gene Sequence | DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN |
| Gene ID - Mouse | ENSMUSG00000020061 |
| Gene ID - Rat | ENSRNOG00000056493 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation) | |
| Datasheet | Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation) | |
| Datasheet | Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation) |
| Citations for Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation) – 2 Found |
| Abdul-Hussein, Saba; van der Ven, Peter F M; Tajsharghi, Homa. Expression profiles of muscle disease-associated genes and their isoforms during differentiation of cultured human skeletal muscle cells. Bmc Musculoskeletal Disorders. 2012;13( 23273262):262. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |