Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA021004-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: myosin binding protein C, slow type
Gene Name: MYBPC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020061: 85%, ENSRNOG00000056493: 86%
Entrez Gene ID: 4604
Uniprot ID: Q00872
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN
Gene Sequence DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN
Gene ID - Mouse ENSMUSG00000020061
Gene ID - Rat ENSRNOG00000056493
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation)
Datasheet Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation)
Datasheet Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation)
Citations for Anti MYBPC1 pAb (ATL-HPA021004 w/enhanced validation) – 2 Found
Abdul-Hussein, Saba; van der Ven, Peter F M; Tajsharghi, Homa. Expression profiles of muscle disease-associated genes and their isoforms during differentiation of cultured human skeletal muscle cells. Bmc Musculoskeletal Disorders. 2012;13( 23273262):262.  PubMed
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed