Anti MXI1 pAb (ATL-HPA056762)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056762-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MXI1
Alternative Gene Name: bHLHc11, MAD2, MXD2, MXI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025025: 100%, ENSRNOG00000034078: 100%
Entrez Gene ID: 4601
Uniprot ID: P50539
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTH |
| Gene Sequence | EHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTH |
| Gene ID - Mouse | ENSMUSG00000025025 |
| Gene ID - Rat | ENSRNOG00000034078 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MXI1 pAb (ATL-HPA056762) | |
| Datasheet | Anti MXI1 pAb (ATL-HPA056762) Datasheet (External Link) |
| Vendor Page | Anti MXI1 pAb (ATL-HPA056762) at Atlas Antibodies |
| Documents & Links for Anti MXI1 pAb (ATL-HPA056762) | |
| Datasheet | Anti MXI1 pAb (ATL-HPA056762) Datasheet (External Link) |
| Vendor Page | Anti MXI1 pAb (ATL-HPA056762) |