Anti MXI1 pAb (ATL-HPA056762)

Atlas Antibodies

SKU: ATL-HPA056762-25

• 

Protein Description: MAX interactor 1, dimerization protein
Gene Name: MXI1
Alternative Gene Name: bHLHc11, MAD2, MXD2, MXI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025025: 100%, ENSRNOG00000034078: 100%
Entrez Gene ID: 4601
Uniprot ID: P50539
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTH
• Gene Sequence: EHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTH
• Gene ID - Mouse: ENSMUSG00000025025
• Gene ID - Rat: ENSRNOG00000034078
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.