Anti MX1 pAb (ATL-HPA030917 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030917-25

Protein Description: MX dynamin-like GTPase 1
Gene Name: MX1
Alternative Gene Name: IFI-78K, MxA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000386: 56%, ENSRNOG00000001959: 60%
Entrez Gene ID: 4599
Uniprot ID: P20591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSS
• Gene Sequence: IEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSS
• Gene ID - Mouse: ENSMUSG00000000386
• Gene ID - Rat: ENSRNOG00000001959
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MX1 pAb (ATL-HPA030917 w/enhanced validation) – 3 Found

Johansson, Henrik J; Sanchez, Betzabe C; Forshed, Jenny; Stål, Olle; Fohlin, Helena; Lewensohn, Rolf; Hall, Per; Bergh, Jonas; Lehtiö, Janne; Linderholm, Barbro K. Proteomics profiling identify CAPS as a potential predictive marker of tamoxifen resistance in estrogen receptor positive breast cancer. Clinical Proteomics. 12(1):8. 

Tan, Yee Sun; Sansanaphongpricha, Kanokwan; Xie, Yuying; Donnelly, Christopher R; Luo, Xiaobo; Heath, Blake R; Zhao, Xinyi; Bellile, Emily; Hu, Hongxiang; Chen, Hongwei; Polverini, Peter J; Chen, Qianming; Young, Simon; Carey, Thomas E; Nör, Jacques E; Ferris, Robert L; Wolf, Gregory T; Sun, Duxin; Lei, Yu L. Mitigating SOX2-potentiated Immune Escape of Head and Neck Squamous Cell Carcinoma with a STING-inducing Nanosatellite Vaccine. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2018;24(17):4242-4255. 

Verver, Daniëlle; Poirier-Colame, Vichnou; Tomasic, Gorana; Cherif-Rebai, Khadija; Grunhagen, Dirk J; Verhoef, Cornelis; Suciu, Stefan; Robert, Caroline; Zitvogel, Laurence; Eggermont, Alexander M M. Upregulation of intratumoral HLA class I and peritumoral Mx1 in ulcerated melanomas. Oncoimmunology. 8(11):e1660121.