Anti MURC pAb (ATL-HPA021021 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021021-25

Protein Description: muscle-related coiled-coil protein
Gene Name: MURC
Alternative Gene Name: cavin-4, CAVIN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028348: 80%, ENSRNOG00000008027: 80%
Entrez Gene ID: 347273
Uniprot ID: Q5BKX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNKFRVVIFQEKFRCPTSLSVVKDRNLTENQEEDDDDIFDPPVDLSSDEEYYVE
• Gene Sequence: KVSAHIKDVKARVEKQQIHVKKVEVKQEEIMKKNKFRVVIFQEKFRCPTSLSVVKDRNLTENQEEDDDDIFDPPVDLSSDEEYYVE
• Gene ID - Mouse: ENSMUSG00000028348
• Gene ID - Rat: ENSRNOG00000008027
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MURC pAb (ATL-HPA021021 w/enhanced validation) – 3 Found

Housley, Michael P; Njaine, Brian; Ricciardi, Filomena; Stone, Oliver A; Hölper, Soraya; Krüger, Marcus; Kostin, Sawa; Stainier, Didier Y R. Cavin4b/Murcb Is Required for Skeletal Muscle Development and Function in Zebrafish. Plos Genetics. 2016;12(6):e1006099. 

Tassin, Alexandra; Leroy, Baptiste; Laoudj-Chenivesse, Dalila; Wauters, Armelle; Vanderplanck, Céline; Le Bihan, Marie-Catherine; Coppée, Frédérique; Wattiez, Ruddy; Belayew, Alexandra. FSHD myotubes with different phenotypes exhibit distinct proteomes. Plos One. 7(12):e51865. 

Olie, Cyriel Sebastiaan; van der Wal, Erik; Cikes, Domagoj; Maton, Loes; de Greef, Jessica C; Lin, I-Hsuan; Chen, Yi-Fan; Kareem, Elsayad; Penninger, Josef M; Kessler, Benedikt M; Raz, Vered. Cytoskeletal disorganization underlies PABPN1-mediated myogenic disability. Scientific Reports. 2020;10(1):17621.