Anti MUC7 pAb (ATL-HPA006411 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006411-25

Protein Description: mucin 7, secreted
Gene Name: MUC7
Alternative Gene Name: FLJ27047, MG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095276: 26%, ENSRNOG00000021614: 28%
Entrez Gene ID: 4589
Uniprot ID: Q8TAX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAP
• Gene Sequence: RRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAP
• Gene ID - Mouse: ENSMUSG00000095276
• Gene ID - Rat: ENSRNOG00000021614
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MUC7 pAb (ATL-HPA006411 w/enhanced validation) – 3 Found

Chaudhury, Nayab M A; Proctor, Gordon B; Karlsson, Niclas G; Carpenter, Guy H; Flowers, Sarah A. Reduced Mucin-7 (Muc7) Sialylation and Altered Saliva Rheology in Sjögren's Syndrome Associated Oral Dryness. Molecular & Cellular Proteomics : Mcp. 2016;15(3):1048-59. 

Storesund, T; Schreurs, O; Messelt, E B; Kolltveit, K M; Schenck, K. Trefoil factor family 3 expression in the oral cavity. European Journal Of Oral Sciences. 2009;117(6):636-43. 

Saitou, Marie; Gaylord, Eliza A; Xu, Erica; May, Alison J; Neznanova, Lubov; Nathan, Sara; Grawe, Anissa; Chang, Jolie; Ryan, William; Ruhl, Stefan; Knox, Sarah M; Gokcumen, Omer. Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva. Cell Reports. 2020;33(7):108402.