Anti MTX3 pAb (ATL-HPA062061)

Atlas Antibodies

Catalog No.:
ATL-HPA062061-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: metaxin 3
Gene Name: MTX3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021704: 88%, ENSRNOG00000023837: 89%
Entrez Gene ID: 345778
Uniprot ID: Q5HYI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRLSLGGISPAGQETVDANLQKLTQLVNKESNLIEKMDDNLRQSPQLPPRKLPTLKLTPAEEENNS
Gene Sequence FRLSLGGISPAGQETVDANLQKLTQLVNKESNLIEKMDDNLRQSPQLPPRKLPTLKLTPAEEENNS
Gene ID - Mouse ENSMUSG00000021704
Gene ID - Rat ENSRNOG00000023837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTX3 pAb (ATL-HPA062061)
Datasheet Anti MTX3 pAb (ATL-HPA062061) Datasheet (External Link)
Vendor Page Anti MTX3 pAb (ATL-HPA062061) at Atlas Antibodies

Documents & Links for Anti MTX3 pAb (ATL-HPA062061)
Datasheet Anti MTX3 pAb (ATL-HPA062061) Datasheet (External Link)
Vendor Page Anti MTX3 pAb (ATL-HPA062061)